JavaScript Menu Courtesy of Milonic.com
From apache@nmr.cabm.rutgers.edu Thu Jul 12 11:38:25 2012
Received: from nmr.cabm.rutgers.edu (nmr.cabm.rutgers.edu [192.76.178.76])
	by spine.nesg.org (8.14.4/8.14.4) with ESMTP id q6CFcPlG029049
	for ; Thu, 12 Jul 2012 11:38:25 -0400
Received: from nmr.cabm.rutgers.edu (localhost.localdomain [127.0.0.1])
	by nmr.cabm.rutgers.edu (8.14.2/8.14.2) with ESMTP id q6CFcPoN026686
	for ; Thu, 12 Jul 2012 11:38:25 -0400
Received: (from apache@localhost)
	by nmr.cabm.rutgers.edu (8.14.2/8.14.2/Submit) id q6CFcPrD026685;
	Thu, 12 Jul 2012 11:38:25 -0400
Date: Thu, 12 Jul 2012 11:38:25 -0400
Message-Id: <201207121538.q6CFcPrD026685@nmr.cabm.rutgers.edu>
From: webmaster@spine.nesg.org
To: spine@spine.nesg.org
Cc:
Subject: Shipment of protein samples from Rutgers University -- Acceptance of package 793776947242
Status: O
X-Status: 
X-Keywords:                  
X-UID: 117

This is an official record of acceptance of a Biological Material(s) Distribution from Rutgers, The State University of New Jersey (RUTGERS).

The accepted package was delivered on 2012-07-11 to Hauptman-Woodward Med. Research Institute, 700 Ellicott Street, Buffalo, NY 14230 and accepted by Angela Lauricella.

The accepted package contained the following samples with the corresponding Protein / DNA sequences:

or34.009; OR34-29.1
MHHHHHHRSGDIQVQNNNTCNGKTFDYTYTVTTESELQKVLNELKDYIKKQGCKRSRTSITARTKKEAEKFAAILIKVYAELGYNDINVTWDGDTVTVEGQLEGVD

or33.015; OR33-29.1
MSGKKVEVQVKITCNGKTYERTYQLYAVRDEELKEKLKKVLNERMDPIKKLGCKRVRISIRVKHSDAAEEKKEAKKFAAILNKVFAELGYNDSNVTWDGDTVTVEGQLEGVDLEHHHHHH

OR278.004; OR278-21.1
MGEMMIIFEGDDLEALEKALKEMIRQARKFAGTVEYWLSGNRLMIRITGVPEQVRKELAKEAERLKAEFNIQVEYQIRGSGSGSGSGEMMIIFEGDDLEALEKALKEMIRQARKFAGTVEYWLSGNRLMIRITGVPEQVRKELAKEAERLKAEFNIQVEYQIRTGSLEHHHHHH

OR204.002; OR204-21.1
MDVLVMVNTSNQDLIDKIKDLVENSGYEVRDVQDSNELKDELKRLAAAKNFKKILVIVNDKDLAKKMLELIKKLGYQVFLLLEDKDEDELKKFEQEIRSKGYEVRRVTDEEEALKIVEEFLKKAGSLEHHHHHH

OR266.002; OR266-21.1
MSELGKRLIEAAENGNKDRVKDLLENGADVNASDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNTSDSDGRTPLDLAREHGNEEVVKLLEKQGGWLEHHHHHH

OR283.001; OR283-52.1
MASWSHPQFEKGALEVLFQGPGMNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDHSYRSVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAENDTITAWGKDHEKDAFEHIVTQFSSVPVSVNSASYDIYNACEKIWGEDLRHLIVSRSTQAPLIINPCSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQTDGVDINTLQEIVEGMKQKMWSIENIAFGSGGGLSQKLTADLLNCAFHCSYVVTNGLGINVFADPVADPNKRTKKGRLSLHRTPAGNFVTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIGSELALVPRGSSAHHHHHHHHHH

OR282.001; OR282-52.1
MASWSHPQFEKGALEVLFQGPGMIIRYATPDDIEDMVSIFIDAYNFPGPRESVKSSFEISLEVQPDGCLLAFLKDEPVGMGCIFFYNKQAWIGLMGVKKAYARRGIGTEVFRRLLEIGRRKVDTIRLDAISCGYGLYKKFKFVDEYRTVRYELMERPIKRVEGVVEVNKIPNWVKEIDKKAFGDDRIRVLEAYMRRGARLLCAENEGFGLVYRGKIGPLVADSPRVAEKILLKAFQLGAREIIIPEVNKDALELIKIFKPSQVTSCMRMRLGSKIEEKVDIYYGILAYAKGGSELALVPRGSSAHHHHHHHHHH

OR257.001; OR257-29.1
MATIRNLKIKTEKCAEWAVRLALALAAVANAWEALLKMKDKGADPYDLKQMENVVGKARAAIQAALAALEAALYDLKSTLAELEETDEKEGPAIEWAKKAVAAVEAAGGGLEHHHHHH

OR256.001; OR256-29.1
MATIDNLKRHTEKCAEWAIKLALALAAVANLWEALIKMKEKGADPSKLKQMENVLGKARAAIPACLAALELALYDLKQTLQQLEQTDEKEGPAIEWAKKAVAAVEAAGGGLEHHHHHH

OR221.001; OR221-21.1
MSKIFVIFSSDPEILKELVKDIRENGVRVILVYRRQDQKDREKWIKEFKKEGVDVRTVQDKEKFRENVREIWERYPQLDVVIIVLSDNKDDLEDFIKEARERGVRVIVVYQSKDEERRREAYQEFKSKGVDVRTVSYKEEMKERVKEFVKRVGSLEHHHHHH

OR281.001; OR281-21.1
MGSMVIMFRGDDLEALEKAVKEMIRQARKFAGTVQYNLKGNTLFIVITGVPEQVRKELAKEAERLKAEFNITVWYQIVGYPGAMVIMFRGDDLEALEKAVKEMIRQARKFAGTVQYNLKGNTLFIVITGVPEQVRKELAKEAERLKAEFNITVWYQISTGSLEHHHHHH

OR279.003; OR279-21.1
MGVMVIVFEGDDLEALEKALKEMIRQARKFAGTVTYTLSGNRLVIVITGVPEQVRKELAKEAERLKAEFNINVQYQIMGSGSVMVIVFEGDDLEALEKALKEMIRQARKFAGTVTYTLSGNRLVIVITGVPEQVRKELAKEAERLKAEFNINVQYQIMTGSLEHHHHHH

OR280.003; OR280-21.1
MGVMVIVFEGDDLEALEKALKEMIRQARKFAGTVTYTLSGNRLVIVITGVPEQVRKELAKEAERLKAEFNINVQYQIMGSGSGVMVIVFEGDDLEALEKALKEMIRQARKFAGTVTYTLSGNRLVIVITGVPEQVRKELAKEAERLKAEFNINVQYQIMTGSLEHHHHHH