JavaScript Menu Courtesy of Milonic.com
From apache@spins2.cabm.rutgers.edu Wed Jul 11 14:12:56 2012
Received: from spins2.cabm.rutgers.edu (localhost [127.0.0.1])
	by spine.nesg.org (8.14.4/8.14.4) with ESMTP id q6BICuVQ024187
	for ; Wed, 11 Jul 2012 14:12:56 -0400
Received: (from apache@localhost)
	by spins2.cabm.rutgers.edu (8.14.4/8.14.4/Submit) id q6BICuSZ024186;
	Wed, 11 Jul 2012 14:12:56 -0400
Date: Wed, 11 Jul 2012 14:12:56 -0400
Message-Id: <201207111812.q6BICuSZ024186@spins2.cabm.rutgers.edu>
From: webmaster@spine.nesg.org
To: spine@spins2.cabm.rutgers.edu
Cc: 
Subject: Shipment of protein samples from Rutgers University: OR33.016, OR278.003, OR266.001, OR283.002, OR282.002, OR279.004, OR280.004 
Status: O
X-Status: 
X-Keywords:                  
X-UID: 115

This is an official record of a Biological Material(s) Distribution from Rutgers, The State University of New Jersey (RUTGERS).

Shipment id: 793776915372
Package shipped to Columbia University, Biology Stock Room, 530 W. 120th St., NY, NY 1007
Package shipped on 2012-07-11

RECIPIENT ACKNOWLEDGES AND AGREES TO THE FOLLOWING:
MATERIAL IS SUPPLIED 'AS IS' WITHOUT WARRANTIES, EXPRESS OR IMPLIED,
INCLUDING ANY WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR
PURPOSE, OR THAT THE USE OF THE MATERIAL WILL NOT INFRINGE ANY PATENT,
COPYRIGHT, TRADEMARK OR PROPRIETARY RIGHTS OF ANY THIRD PARTY.
FURTHERMORE, RUTGERS MAKES NO WARRANTY OR REPRESENTATIONS AS TO
THE PURITY, ACTIVITY, SAFETY OR USEFULNESS OF THE MATERIALS.

THESE BIOLOGICAL MATERIALS ARE PROVIDED UNDER THE TERMS OF A SIGNED
MATERIALS TRANSFER AGREEMENT (MTA) WITH RUTGERS.  THEY MAY BE USED FOR
RESEARCH PURPOSES ONLY.  THESE MATERIALS MAY NOT BE USED FOR COMMERCIAL
PURPOSES, OR TO GENERATE OR SELECT MATERIALS THAT ARE THEN USED FOR
COMMERCIAL  PURPOSES (INCLUDING ANTIBODIES OR AFFINITY CAPTURE REAGENTS)
WITHOUT WRITTEN AUTHORIZATION FROM RUTGERS.

THE FURNISHING OF MATERIALS SHALL NOT CONSTITUTE A GRANT OR LICENSE UNDER
ANY LEGAL RIGHTS NOW OR HEREINAFTER HELD BY RUTGERS.

MATERIAL IS TO BE USED WITH CAUTION IN ANY EXPERIMENTAL WORK SINCE ALL
OF ITS CHARACTERISTICS ARE NOT KNOWN AND MAY BE INFECTIOUS, TOXIC,
OR HAZARDOUS. DO NOT USE IN HUMANS.


When you have received the package, please visit the address below and acknowledge delivery:

http://spine.nesg.org/shipment_forms/793776915372.cgi

Acknowledging the shipment via the web address above is our official record of sample exchange.

Thank you.

Samples in package: 

OR33.016; OR33-29.1
MSGKKVEVQVKITCNGKTYERTYQLYAVRDEELKEKLKKVLNERMDPIKKLGCKRVRISIRVKHSDAAEEKKEAKKFAAILNKVFAELGYNDSNVTWDGDTVTVEGQLEGVDLEHHHHHH

OR278.003; OR278-21.1
MGEMMIIFEGDDLEALEKALKEMIRQARKFAGTVEYWLSGNRLMIRITGVPEQVRKELAKEAERLKAEFNIQVEYQIRGSGSGSGSGEMMIIFEGDDLEALEKALKEMIRQARKFAGTVEYWLSGNRLMIRITGVPEQVRKELAKEAERLKAEFNIQVEYQIRTGSLEHHHHHH

OR266.001; OR266-21.1
MSELGKRLIEAAENGNKDRVKDLLENGADVNASDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNTSDSDGRTPLDLAREHGNEEVVKLLEKQGGWLEHHHHHH

OR283.002; OR283-52.1
MASWSHPQFEKGALEVLFQGPGMNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDHSYRSVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAENDTITAWGKDHEKDAFEHIVTQFSSVPVSVNSASYDIYNACEKIWGEDLRHLIVSRSTQAPLIINPCSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQTDGVDINTLQEIVEGMKQKMWSIENIAFGSGGGLSQKLTADLLNCAFHCSYVVTNGLGINVFADPVADPNKRTKKGRLSLHRTPAGNFVTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIGSELALVPRGSSAHHHHHHHHHH

OR282.002; OR282-52.1
MASWSHPQFEKGALEVLFQGPGMIIRYATPDDIEDMVSIFIDAYNFPGPRESVKSSFEISLEVQPDGCLLAFLKDEPVGMGCIFFYNKQAWIGLMGVKKAYARRGIGTEVFRRLLEIGRRKVDTIRLDAISCGYGLYKKFKFVDEYRTVRYELMERPIKRVEGVVEVNKIPNWVKEIDKKAFGDDRIRVLEAYMRRGARLLCAENEGFGLVYRGKIGPLVADSPRVAEKILLKAFQLGAREIIIPEVNKDALELIKIFKPSQVTSCMRMRLGSKIEEKVDIYYGILAYAKGGSELALVPRGSSAHHHHHHHHHH

OR279.004; OR279-21.1
MGVMVIVFEGDDLEALEKALKEMIRQARKFAGTVTYTLSGNRLVIVITGVPEQVRKELAKEAERLKAEFNINVQYQIMGSGSVMVIVFEGDDLEALEKALKEMIRQARKFAGTVTYTLSGNRLVIVITGVPEQVRKELAKEAERLKAEFNINVQYQIMTGSLEHHHHHH

OR280.004; OR280-21.1
MGVMVIVFEGDDLEALEKALKEMIRQARKFAGTVTYTLSGNRLVIVITGVPEQVRKELAKEAERLKAEFNINVQYQIMGSGSGVMVIVFEGDDLEALEKALKEMIRQARKFAGTVTYTLSGNRLVIVITGVPEQVRKELAKEAERLKAEFNINVQYQIMTGSLEHHHHHH



Sender notes: