JavaScript Menu Courtesy of Milonic.com


      Add structure in progress flag     No structures in progress

There are 2 sequencing results for this construct in the database which are linked below.

        The assembled contig was last edited by Spine on 2014-05-30

      A contig was assembled from the available sequencing results.
      The contig appears to be complete. Both pre-linker and post-linker sequences were found in the contig.
     Edit this construct record

>contig sequence color coded based on base call confidences ( red[low] - green[high]; grey[no data] )
ATGTCGGAACTGGGCAAACGCCTGATTGAAGCGGCTGAAAATGGTAATAAAGATCGTGTG
AAAGACCTGCTGGAAAATGGTGCGGATGTTAACGCTAGCGATTCTGACGGCAAAACCCCG
CTGCATCTGGCGGCCGAAAATGGTCACAAAGAAGTGGTTAAGCTGCTGCTGAGTCAGGGC
GCAGATCCGAACGCTAAAGATTCCGACGGCAAGACGCCGCTGCATCTGGCAGCTGAAAAT
GGCCACAAAGAAGTCGTGAAGCTGCTGCTGTCACAAGGCGCGGATCCGAACGCCAAAGAT
TCGGACGGTAAGACGCCGCTGCACCTGGCGGCCGAAAACGGTCACAAAGAAGTTGTCAAG
CTGCTGCTGAGCCAAGGTGCAGATCCGAACACTAGTGATTCTGACGGTCGTACGCCGCTG
GACCTGGCGCGCGAACATGGTAATGAAGAAGTGGTTAAACTGCTGGAAAAGCAAGGCGGT
TGGCTCGAGCACCACCACCACCACCACTGA



Global alignment between contig sequence and expected construct sequence.
Note - Both the start and the end of the coding sequence were found in the sequencing data.


Global alignment can not be generated -- expected sequence or experimental sequence not available.

Alignment discrepancies: none


Alignment between translated sequencing result and expected expressed amino acid sequence.
Note - Both the start and the end of the coding sequence were found in the sequencing data.

expected        MSELGKRLIEAAENGNKDRVKDLLENGADVNASDSDGKTPLHLAAENGHKEVVKLLLSQG
result          MSELGKRLIEAAENGNKDRVKDLLENGADVNASDSDGKTPLHLAAENGHKEVVKLLLSQG
                ************************************************************

expected        ADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVK
result          ADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVK
                ************************************************************

expected        LLLSQGADPNTSDSDGRTPLDLAREHGNEEVVKLLEKQGGWLEHHHHHH
result          LLLSQGADPNTSDSDGRTPLDLAREHGNEEVVKLLEKQGGWLEHHHHHH
                *************************************************

Alignment discrepancies: none


Details about individual sequencing results

Allow Spine to auto-assemble contig
phrap crossmatch vector file      



    NESG_16759_OR266-21.1.ab1     used for contig assembly: Y     direction: forward     longest good quality read: 506 NT     average base call quality score: 57.53

Alignment of translated auto-read sequencing result to expected amino acid sequence.
Note - Both the start and the end of the coding sequence were found in the sequencing data.


expected        MSELGK------------------------------RLIEAAENGNKDRVKDLLENGADV
result          MVGTGQTPD*SG*KW**RSCERPAGKWCGC*R*RF*RQNPAASGGRK-------------
                *   *:                              *   **..*.*             

expected        NASDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLH----LAAENGHKEVV
result          -WSQRSG*A----AAESGRRSER*RFRRQDA---AASGS*KWPQRSREAAAVTRRGSERQ
                  *: .* :    ***.*::.    :  *.*   * ... * * :     *. .  .*  

expected        KLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNTSDSDGRT------PL
result          RFGR*DAAAPGGRKRSQRSCQAAAEPRCRSEH**F*RSYAAGPGARTW**RSG*TAGKAR
                ::   :.* *..:. . ::    *  . :.*   :  * .*.*.:     *:      . 

expected        DLAREHGNEEVVKLLEKQGGWLEHHHHHH
result          RLARAPPPPPL------------------
                 ***      :                  


Alignment of auto-read sequencing result to expected nucleotide sequence.
Can not generate global nt alignment because the expected construct nt sequence is not in the database.



    NESG_16760_OR266-21.1.ab1     used for contig assembly: Y     direction: reverse     longest good quality read: 510 NT     average base call quality score: 66.95

Alignment of translated auto-read sequencing result to expected amino acid sequence.
Note - Both the start and the end of the coding sequence were found in the sequencing data.


expected        MSELGKRLIEAAENGNKDRVKDLLENGADVNASDSDGKTPLHLAAENGHKEVVKLLLSQG
result          MSELGKRLIEAAENGNKDRVKDLLENGADVNASDSDGKTPLHLAAENGHKEVVKLLLSQG
                ************************************************************

expected        ADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVK
result          ADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVK
                ************************************************************

expected        LLLSQGADPNTSDSDGRTPLDLAREHGNEEVVKLLEKQGGWLEHHHHHH
result          LLLSQGADPNTSDSDGRTPLDLAREHGNEEVVKLLEKQGGWLEHHHHHH
                *************************************************


Alignment of auto-read sequencing result to expected nucleotide sequence.
Can not generate global nt alignment because the expected construct nt sequence is not in the database.





Below are the top results from select BLAST searches (max 10 results per search):

Search not performed because the sequencing results matched the expected sequence.