JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

Hr9151a.009
target record [HR9151A]
construct record [HR9151A-187-287-15.5]
expression record [HR9151A-187-287-15.5-NC5b]
purification record [HR9151A-187-287-15.5-NC5b-GF]

Proteus 2.0 ( access )

PST label: no lablel
Current location: Buffalo
PST buffer: Low Salt - 5 mM DTT 100 mM NaCl 10 mM Tris-HCl pH 7.5 0.02 % NaN3
PST volume: 0.55 mL
PST protein concentration: 0.39 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
HR9151A-187-287-15.5-NC5a-25666F1.ab1
HR9151A-187-287-15.5-NC5a-25694F1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   Buffalo ( 2012-11-13 )

Sequence   (purification tags are colored blue)
MGHHHHHHSHMPKATAQMEEKLRDFTRAYEPDSVLPLADGVLSFIHHQIIE
LARDCLTKSRDGLITTVYFYELQENLEKLLQDAYERSESLEVAFVTQLVKK
LLIIISRPAR


Sequence stats ( 112 residues )
Met: 3 Gly: 3 Cys: 1 Pro: 4 Asn: 1
Ile: 7 Leu: 15 Val: 6 Trp: 0 Gln: 5

Sample precipitation:
Unkown

Recommended authors:
Keith Hamilton, Rong Xiao

Experimental records:   (HSQC)  

Create new structure record:   (HSQC)   (NMR)   (Xray)