JavaScript Menu Courtesy of Milonic.com
LkR112.011
target record [LkR112]
construct record [LkR112-36-127-21.11] ( Pxs: 0.093 )
expression record [LkR112-36-127-21.11-SeMa]
purification record [LkR112-36-127-21.11-SeMa-GF]
aggregation screening [screening record] (purification batch level data)

PST label: LkR112-36-127-6xHis
Current location: HWI
PST buffer: low salt -- 100mM NaCl, 5mM DTT, 0.02% NaN3, 10mM Tris-HCl pH 7.5
PST volume: 0.45 mL
PST protein concentration: 11.2 mg/mL
PST tube format: 1.7mL Eppendorf

Available construct sequencing results:
LkR112-36-127-21.11-NC5a-21077R1.ab1
LkR112-36-127-21.11-NC5a-21661F1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   HWI ( 2009-08-19 )

Sequence   (purification tags are colored blue, mutant residues are colored red)
MKNTGDEVVAIISQNGKVIREIPLTGHKGNEQFTIKGKGAQYNLMEVDGER
IRIKEDNSPDQVGVKMGWKSKAGDTIVCLPHKVFVEIKSTQKLEHHHHHH


Sequence stats ( 101 residues )
Met: 2 Gly: 10 Cys: 1 Pro: 3 Asn: 5
Ile: 9 Leu: 4 Val: 9 Trp: 1 Gln: 5

No comments associated with this pst id.

Sample precipitation:
Unkown

Recommended authors:
Dan Lee, Daya J. Patel, Colleen Ciccosanti, Seema Sahdev , T.B. Acton, R. Xiao, J.K. Everett, G.T. Montelione, Northeast Structural Genomics Consortium (NESG)

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)