JavaScript Menu Courtesy of Milonic.com
PaR198.023
target record [PaR198]
construct record [PaR198-L80M-21.7]
expression record [PaR198-L80M-21.7-SeM-R1]
purification record [PaR198-L80M-21.7-SeM-R1-GF]
aggregation screening [screening record] (purification batch level data)

PST label: PaR198-0-130-6xHis
Current location: G8-E1-11
PST buffer: low salt -- 100mM NaCl, 5mM DTT, 0.02% NaN3, 10mM Tris-HCl pH 7.5
PST volume: 4.5 mL
PST protein concentration: 9.75 mg/mL
PST tube format: 15mL cent. tube

(Ship this sample)

Sequence   (purification tags are colored blue, mutant residues are colored red)
MTRAINDPGNEDPGSLLETDADALLGGAAAQAPEERCRLAAQACIRACERY
LALCTESSREQRQHAGDCADLCRLAALLMERRSPWAPAACELAARYALACA
ERCDGDEPLERECAGACRRFVEACRPLLPALEHHHHHH

Sequence stats ( 140 residues )
Met: 2 Gly: 7 Cys: 12 Pro: 8 Asn: 2
Ile: 2 Leu: 17 Val: 1 Trp: 1 Gln: 4

No comments associated with this pst id.

Sample precipitation:
Unkown

Recommended authors:
No authors listed

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)