JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

SR449.005 parent PST record: SR449.002
target record [SR449]
construct record [SR449-21.3]
expression record [SR449-21.3-NC5a]
purification record [SR449-21.3-NC5a-GF]

Proteus 2.0 ( access )

PST label: SR449-1-103-6xHis
PST buffer: NMR Buffer 5.5 - 10 % D2O 1 X Proteinase Inhibitors 0.02 % NaN3 10 mM DTT 5 mM CaCL2 100 mM NaCL 20 mM NH4OAc pH 5.5 50 uM DSS
PST volume: 0.05 mL
PST protein concentration: 0.72 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

(Ship this sample)
Last shipment sent to:   ( 2006-04-06 )

Sequence   (purification tags are colored blue)
MFTAKLIKGKTYNVMGITFRAGVSQTVPKKLYEYLNENPYFILTQELNNQK
DDPINYTESELKGMNKAEHESIISNLGRNPSDFKNADERIAYILKQIDNKG
ELEHHHHHH


Sequence stats ( 111 residues )
Met: 3 Gly: 6 Cys: 0 Pro: 4 Asn: 11
Ile: 9 Leu: 9 Val: 3 Trp: 0 Gln: 4

Sample precipitation:
Unkown

Recommended authors:
No authors listed

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)