JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

SR547.006
target record [SR547]
construct record [SR547-21.2]
expression record [SR547-21.2-NC5b]
purification record [SR547-21.2-NC5b-GF]

Proteus 2.0 ( access )

PST label: SR547-1-100-6xHis
Current location: UGA
PST buffer: NMR buffer 4.5 - 1 X Proteinase Inhibitors 0.02 % NaN3 10 mM DTT 5 mM CaCL2 100 mM NaCL 20 mM NH4OAc pH 4.5 10 % D2O 50 uM DSS
PST volume: 0.5 mL
PST protein concentration: 0.79 mM
PST tube format: NMR tube
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
KC-PL11-C04-T7.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2006-11-16 )

Sequence   (purification tags are colored blue)
MNKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMN
KFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELLLE
HHHHHH


Sequence stats ( 108 residues )
Met: 3 Gly: 6 Cys: 0 Pro: 3 Asn: 10
Ile: 7 Leu: 10 Val: 6 Trp: 1 Gln: 4

Sample precipitation:
Unkown

Recommended authors:
No authors listed

Experimental records:   (HSQC)  

Create new structure record:   (HSQC)   (NMR)   (Xray)