JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

SiR5.001
target record [SiR5]
construct record [SiR5-21.2]
expression record [SiR5-21.2-NC5a]
purification record [SiR5-21.2-NC5a-GF]

Proteus 2.0 ( access )

PST label: SiR5-1-93-6xHis
Current location: UGA
PST buffer: NMR buffer 6.5 - 0.02 % NaN3 10 mM DTT 5 mM CaCL2 100 mM NaCL 1 x Proteinase Inhibitors 20 mM MES pH 6.5 10 % D2O 50 uM DSS
PST volume: 0.5 mL
PST protein concentration: 1.15 mM
PST tube format: NMR tube
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
KC-PL11-B01-T7.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2006-11-06 )

Sequence   (purification tags are colored blue)
MMFLRKVEGPRSVTLPDGSIMTRADLPPANTRRWVASRKIAVVRGVIYGLI
TLAEAKQIYGLSDEEFNSWVSALAEHGKDALKVTALKKYRQLLEHHHHHH


Sequence stats ( 101 residues )
Met: 3 Gly: 6 Cys: 0 Pro: 4 Asn: 2
Ile: 5 Leu: 11 Val: 8 Trp: 2 Gln: 2

Sample precipitation:
Unkown

Recommended authors:
No authors listed

Experimental records:   (HSQC)  

Create new structure record:   (HSQC)   (NMR)   (Xray)