JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

SoR190.010
target record [SoR190]
construct record [SoR190-21.2]
expression record [SoR190-21.2-NC5b]
purification record [SoR190-21.2-NC5b-GF]

Proteus 2.0 ( access )

PST label: SoR190-1-110-6xHis
Current location: UGA
PST buffer: NMR buffer 5.5 - 10 % D2O 1 X Proteinase Inhibitors 0.02 % NaN3 10 mM DTT 5 mM CaCL2 100 mM NaCL 20 mM NH4OAc pH 5.5 50 uM DSS
PST volume: 0.6 mL
PST protein concentration: 1.50 mM
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
SoR190-21.2-SeMa-18255-18460-18303-17996F1.ab1
SoR190-21.2-SeMa-17973R1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2007-07-31 )

Sequence   (purification tags are colored blue)
MSGWYELSKSSNDQFKFVLKAGNGEVILTSELYTGKSGAMNGIESVQTNSP
IEARYAKEVAKNDKPYFNLKAANHQIIGTSQMYSSTAARDNGIKSVMENGK
TTTIKDLTLEHHHHHH


Sequence stats ( 118 residues )
Met: 4 Gly: 9 Cys: 0 Pro: 2 Asn: 9
Ile: 7 Leu: 7 Val: 5 Trp: 1 Gln: 4

Sample precipitation:
Unkown

Recommended authors:
No authors listed

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)