JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

SoR77.009
target record [SoR77]
construct record [SoR77-21.3]
expression record [SoR77-21.3-NC5b]
purification record [SoR77-21.3-NC5b-GF]

Proteus 2.0 ( access )

PST label: SoR77-1-72-6xHis
Current location: UGA
PST buffer: NMR buffer 5.5 - 10 % D2O 1 X Proteinase Inhibitors 0.02 % NaN3 10 mM DTT 5 mM CaCL2 100 mM NaCL 20 mM NH4OAc pH 5.5 50 uM DSS
PST volume: 0.5 mL
PST protein concentration: 1.00 mM
PST tube format: NMR tube
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
SoR77-21.3-SeMa-17312R1.ab1
SoR77-21.3-SeMa-17973F1.ab1
SoR77-21.3-SeMa-17312F1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2007-08-15 )

Sequence   (purification tags are colored blue)
MAIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPS
ESRQAVAEQFAKALAQSVKSNLEHHHHHH


Sequence stats ( 80 residues )
Met: 2 Gly: 1 Cys: 1 Pro: 2 Asn: 3
Ile: 3 Leu: 10 Val: 7 Trp: 0 Gln: 5

Sample precipitation:
Unkown

Recommended authors:
No authors listed

Experimental records:   (HSQC)  

Create new structure record:   (HSQC)   (NMR)   (Xray)