JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

ahr99.015
target record [AhR99]
construct record [AhR99-21.3]
expression record [AhR99-21.3-NC5b]
purification record [AhR99-21.3-NC5b-GF]

Proteus 2.0 ( access )

PST label: AhR99-1-136-6xHis
Current location: UGA
PST buffer: NMR buffer 6.5 - 0.02 % NaN3 10 mM DTT 5 mM CaCL2 100 mM NaCL 1 x Proteinase Inhibitors 20 mM MES pH 6.5 10 % D2O 50 uM DSS
PST volume: 0.5 mL
PST protein concentration: 1.00 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
AhR99-21.3-23805R1.ab1
AhR99-21.3-23691F2.ab1
AhR99-21.3-23691F1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2011-03-09 )

Sequence   (purification tags are colored blue)
MKISIEAHIEQEIEAVWWAWNDPDCIARWNAASSDWHTTGSRVDLVVGGRF
CHHMAAKDGSAGFDFTGTFTRVEAPTRLSFVMDDGREVDVQFASEPGGTWV
QETFDAETSHTPAQQQAGWQGILDNFKRYVEAAGLEHHHHHH


Sequence stats ( 144 residues )
Met: 3 Gly: 12 Cys: 2 Pro: 4 Asn: 3
Ile: 6 Leu: 4 Val: 10 Trp: 7 Gln: 7

Sample precipitation:
Unkown

Recommended authors:
Dongyan Wang, Colleen Ciccosanti, Haleema JanjuaR. Nair, B. Rost, , T.B. Acton, R. Xiao, J.K. Everett, G.T. Montelione, Northeast Structural Genomics Consortium (NESG)

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)