PST (Protein Sample Tube) information

		btr376.010
		target record	[BtR376]
		construct record	[BtR376-27-147-21.4]
		expression record	[BtR376-27-147-21.4-NC5b]
		purification record	[BtR376-27-147-21.4-NC5b-GF]

PST label:		BtR376-27-147-6xHis
Current location:		Inbox
PST buffer:		NMR buffer 6.5 -- 0.02% NaN3, 10mM DTT, 5mM CaCL2, 100mM NaCL, 1x Proteinase Inhibitors, 20mM MES pH 6.5, 10% D2O, 50uM DSS
PST volume:		0.5 mL
PST protein concentration:		0.95 mM
PST tube format:		1.7mL Eppendorf

Available construct sequencing results:
BtR376-27-147-21.4-22593R1.ab1
BtR376-27-147-21.4-22892F1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to: UGA ( 2010-04-21 )

Sequence (purification tags are colored blue, mutant residues are colored red)
MNDDVDIQQSYPFSIETMPVPKKLKVGETAEIRCQLHRDGRFEETKYFIRY
FQPDGAGTLKMSDGTVLLPNDLYPLPGETFRLYYTSASTDQQTVDVYFQDS
FGQLQQLTFSFNNDSSKEEELEHHHHHH

Sequence stats ( 130 residues )

Met:	3		Gly:	7		Cys:	1		Pro:	7		Asn:	4
Ile:	4		Leu:	11		Val:	6		Trp:	0		Gln:	10

No comments associated with this pst id.

Sample precipitation:
Unkown

Recommended authors:
Dongyan Wang, Colleen Ciccosanti, Haleema Janjua , T.B. Acton, R. Xiao, J.K. Everett, G.T. Montelione, Northeast Structural Genomics Consortium (NESG)

No structure records are associated with this pst.

Create new structure record: (HSQC) (NMR) (Xray)