JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

fr824j.004
target record [FR824J]
construct record [FR824J-414-504-Av6HT.1]
expression record [FR824J-414-504-Av6HT.1-NC5b]
purification record [FR824J-414-504-Av6HT.1-NC5b-GF]

Proteus 2.0 ( access )

PST label: no lablel
Current location: Buffalo
PST buffer: NMR Buffer 6.5 - 0.02 % NaN3 10 mM DTT 5 mM CaCL2 100 mM NaCL 1 x Proteinase Inhibitors 20 mM MES pH 6.5 10 % D2O 50 uM DSS
PST volume: 0.5 mL
PST protein concentration: 0.40 mM
PST tube format: NMR tube
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
FR824J-414-504-Av6HT.1-NC5a-T7_Terminator_12DEC12JSR1.ab1
FR824J-414-504-Av6HT.1-NC5a-T7_22Jan13LMF1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   Buffalo ( 2013-08-05 )

Sequence   (purification tags are colored blue)
MSGLNDIFEAQKIEWHEHHHHHHENLYFQSHMSGGSPLATGTTANTRGASQ
KKGGEPPALIVDPLMKYICHICNRGDVEESMLLCDGCDDSYHTFCLLPPLT
SIPKGEWLCPRCVVEEVSKPQ


Sequence stats ( 123 residues )
Met: 4 Gly: 10 Cys: 7 Pro: 9 Asn: 4
Ile: 6 Leu: 11 Val: 5 Trp: 2 Gln: 4

Sample precipitation:
Unkown

Recommended authors:
Haleema Janjua, Rong Xiao

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)