JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

hmr11.009 parent PST record: HmR11.008
target record [HmR11]
construct record [HmR11-21.3]
expression record [HmR11-21.3-NC5b]
purification record [HmR11-21.3-NC5b-GF]

Proteus 2.0 ( access )

PST label: HmR11-1-182-6xHis
Current location: UGA
PST buffer: NMR buffer 6.5 - 0.02 % NaN3 10 mM DTT 5 mM CaCL2 100 mM NaCL 1 x Proteinase Inhibitors 20 mM MES pH 6.5 10 % D2O 50 uM DSS
PST volume: 0.5 mL
PST protein concentration: 0.75 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
HmR11-21.3-SeMa-24404F1.ab1
HmR11-21.3-SeMa-24494F1.ab1
HmR11-21.3-SeMa-23805R1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2011-04-13 )

Sequence   (purification tags are colored blue)
MDEDTEDWETQLQANRDEKDRFFSEHRQSPIPPEERDDFDGLSYFDPDPDY
RVEATVTVHETPESVDLETSDDRTVRYLHVATLSFDLDGESRDLHAFRQAA
DESRTLFVPFRDKTTGQQSYDGGRYMELEPDRDLSDGDEITLDFNLAYSPF
CAYSDTFSCPLPPESNWLETAVTAGERTDLEHHHHHH


Sequence stats ( 190 residues )
Met: 2 Gly: 7 Cys: 2 Pro: 12 Asn: 3
Ile: 2 Leu: 15 Val: 8 Trp: 2 Gln: 6

Sample precipitation:
Unkown

Recommended authors:
Haleema Janjua, Colleen Ciccosanti,Huang Wang, Thomas B. Acton, Rong Xiao, John K. Everett, Gaetano T. Montelione

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)