JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

hr2876c.006
target record [HR2876C]
construct record [HR2876C-162-247-15.3
expression record [HR2876C-162-247-15.3-NC5a]   [HR2876C-162-247-15.3-NC5b]  
purification record [HR2876C-162-247-15.3-[NC5a,NC5b]-GF]

Proteus 2.0 ( access )

PST label: no lablel
Current location: UGA
PST buffer: NMR Buffer 6.5 - 0.02 % NaN3 10 mM DTT 5 mM CaCL2 100 mM NaCL 1 x Proteinase Inhibitors 20 mM MES pH 6.5 10 % D2O 50 uM DSS
PST volume: 0.9 mL
PST protein concentration: 1.00 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

(Ship this sample)
Last shipment sent to:   UGA ( 2012-11-15 )

Sequence   (purification tags are colored blue)
MGHHHHHHSHMGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGI
VQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESD


Sequence stats ( 97 residues )
Met: 5 Gly: 9 Cys: 2 Pro: 3 Asn: 2
Ile: 8 Leu: 6 Val: 8 Trp: 0 Gln: 6

Sample precipitation:
Unkown

Recommended authors:
Haleema Janjua, Rong Xiao

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)