JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

hr4436b.017
target record [HR4436B]
construct record [HR4436B-540-602-14.1]
expression record [HR4436B-540-602-14.1-NC5c]
purification record [HR4436B-540-602-14.1-NC5c-GF]
aggregation screening [screening record] (purification batch level data)

Proteus 2.0 ( access )

PST label: HR4436B-6xHis-540-602
Current location: UGA
PST buffer: NMR 6.5 with Zn++ - 50 uM DSS 10 mM DTT 50 uM ZnSO4 0.02 % NaN3 100 mM NaCL 20 mM MES pH 6.5 1 X Proteinase Inhibitors 10 % D2O 50 uM DSS
PST volume: 0.5 mL
PST protein concentration: 0.65 mM
PST tube format: NMR tube
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
HR4436B-540-602-14.1-22593R1.ab1
HR4436B-540-602-14.1-22964F1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2010-09-14 )

Sequence   (purification tags are colored blue)
MGHHHHHHSHMTHSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNIC
GAQFNRPANLKTHTRIHSGEKPY


Sequence stats ( 74 residues )
Met: 2 Gly: 5 Cys: 4 Pro: 4 Asn: 4
Ile: 2 Leu: 2 Val: 1 Trp: 0 Gln: 2

Sample precipitation:
Unkown

Recommended authors:
Ritu Shastry, Colleen Ciccosanti, Haleema Janjua , T.B. Acton, R. Xiao, J.K. Everett, G.T. Montelione, Northeast Structural Genomics Consortium (NESG)

Experimental records:   (HSQC)  

Create new structure record:   (HSQC)   (NMR)   (Xray)