JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

hr4490c.002
target record [HR4490C]
construct record [HR4490C-209-280-NHT.2]
expression record [HR4490C-209-280-NHT.2-NC5a]
purification record [HR4490C-209-280-NHT.2-NC5a-GF]

Proteus 2.0 ( access )

PST label: HR4490C-6xHis-209-280
Current location: Buffalo
PST buffer: Low Salt - 5 mM DTT 100 mM NaCl 10 mM Tris-HCl pH 7.5 0.02 % NaN3
PST volume: 0.45 mL
PST protein concentration: 0.56 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
HR4490C-209-280-NHT.2-SeMa-24842R1.ab1
HR4490C-209-280-NHT.2-SeMa-24966F1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   Buffalo ( 2012-08-30 )

Sequence   (purification tags are colored blue)
MDVEAWLDERVPLVETHHHHHHENLYFQSHMSNKGKKRRNRTTFTSYQLEE
LEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQ
Q


Sequence stats ( 103 residues )
Met: 4 Gly: 2 Cys: 0 Pro: 2 Asn: 4
Ile: 0 Leu: 7 Val: 7 Trp: 3 Gln: 9

Sample precipitation:
Unkown

Recommended authors:
No authors listed

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)