JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

hr4783b.005
target record [HR4783B]
construct record [HR4783B-262-321-TEV.4]
expression record [HR4783B-262-321-TEV.4-NC5d]
purification record [HR4783B-262-321-TEV.4-NC5d-GF]

Proteus 2.0 ( access )

PST label: HR4783B-6xHis-262-321
Current location: Buffalo
PST buffer: Low Salt - 5 mM DTT 100 mM NaCl 10 mM Tris-HCl pH 7.5 0.02 % NaN3
PST volume: 0.27 mL
PST protein concentration: 0.16 mM
PST tube format: NMR tube
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
HR4783B-262-321-TEV.4-NC5a-24842R1.ab1
HR4783B-262-321-TEV.4-NC5a-25063F1.ab1
HR4783B-262-321-TEV.4-T7Terminator_06MAY13JSR1.ab1
HR4783B-262-321-TEV.4-T7_26APR2013_TNF1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   Buffalo ( 2012-08-30 )

Sequence   (purification tags are colored blue)
MDVEAWLDERVPLVETHHHHHHENLYFQSHMSASRRVGLSCANCQTTTTTL
WRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRK


Sequence stats ( 91 residues )
Met: 4 Gly: 5 Cys: 4 Pro: 4 Asn: 4
Ile: 1 Leu: 8 Val: 6 Trp: 2 Gln: 3

Sample precipitation:
Unkown

Recommended authors:
No authors listed

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)