JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

hr7614b.026 parent PST record: HR7614B.004
target record [HR7614B]
construct record [HR7614B-424-497-15.10]
expression record [HR7614B-424-497-15.10-NC5a]
purification record [HR7614B-424-497-15.10-NC5a-GF]
aggregation screening [screening record] (purification batch level data)

Proteus 2.0 ( access )

PST label: HR7614B-6xHis-424-497
Current location: UGA
PST buffer: NMR buffer 6.5 - 0.02 % NaN3 10 mM DTT 5 mM CaCL2 100 mM NaCL 1 x Proteinase Inhibitors 20 mM MES pH 6.5 10 % D2O 50 uM DSS
PST volume: 0.5 mL
PST protein concentration: 1.65 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
HR7614B-424-497-15.10-SeMa-24842R1.ab1
HR7614B-424-497-15.10-SeMa-24966F1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2012-07-19 )

Sequence   (purification tags are colored blue)
MGHHHHHHSHMGDGEGAGVLGLSASAECHLCPVCGESFASKGAQERHLRLL
HAAQVFPCKYCPATFYSSPGLTRHINKCHPSENR


Sequence stats ( 85 residues )
Met: 2 Gly: 9 Cys: 6 Pro: 5 Asn: 2
Ile: 1 Leu: 7 Val: 3 Trp: 0 Gln: 2

Sample precipitation:
Unkown

Recommended authors:
No authors listed

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)