JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

hr7784a.012
target record [HR7784A]
construct record [HR7784A-370-456-15.5]
expression record [HR7784A-370-456-15.5-NC5d]
purification record [HR7784A-370-456-15.5-NC5d-GF]

Proteus 2.0 ( access )

PST label: HR7784A-6xHis-370-456
Current location: UGA
PST buffer: NMR Buffer 6.5 - 0.02 % NaN3 10 mM DTT 5 mM CaCL2 100 mM NaCL 1 x Proteinase Inhibitors 20 mM MES pH 6.5 10 % D2O 50 uM DSS
PST volume: 0.5 mL
PST protein concentration: 0.66 mM
PST tube format: NMR tube
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
HR7784A-370-456-15.5-NC5a-25063F1.ab1
HR7784A-370-456-15.5-NC5a-24842R1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2012-07-11 )

Sequence   (purification tags are colored blue)
MGHHHHHHSHMRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTC
RQKASLNWHMKKHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEV


Sequence stats ( 98 residues )
Met: 4 Gly: 4 Cys: 7 Pro: 2 Asn: 3
Ile: 4 Leu: 3 Val: 4 Trp: 1 Gln: 3

Sample precipitation:
Unkown

Recommended authors:
No authors listed

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)