JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

hr7992a.005
target record [HR7992A]
construct record [HR7992A-155-216-15.7]
expression record [HR7992A-155-216-15.7-NC5e]
purification record [HR7992A-155-216-15.7-NC5e-GF]

Proteus 2.0 ( access )

PST label: HR7992A-6xHis-155-216
Current location: UGA
PST buffer: Low Salt pH 7.5+Zn -
PST volume: 1 mL
PST protein concentration: 0.50 mM
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
HR7992A-155-216-15.7-15TEV.1-NCa-T7_31OCT2012JSF1.ab1
HR7992A-155-216-15.7-15TEV.1-NCa-T7_Term_31OCT2012JSR1.ab1
HR7992A-155-216-15.7-15TEV.2-NCa-T7_Term_31OCT2012JSR1.ab1
HR7992A-155-216-15.7-15TEV.2-NCa-T7_31OCT2012JSF1.ab1
HR7992A-155-216-15.7-NC5a-24966F1.ab1
HR7992A-155-216-15.7-NC5a-24842R1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2011-12-21 )

Sequence   (purification tags are colored blue)
MGHHHHHHSHMPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGA
SFTQKGNLLRHIKLHSGEKPFK


Sequence stats ( 73 residues )
Met: 4 Gly: 8 Cys: 5 Pro: 4 Asn: 4
Ile: 2 Leu: 5 Val: 4 Trp: 0 Gln: 2

Sample precipitation:
Unkown

Recommended authors:
No authors listed

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)