JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

hr8910c.002
target record [HR8910C]
construct record [HR8910C-NHT.1]
expression record [HR8910C-NHT.1-Na]
purification record [HR8910C-NHT.1-Na]

Proteus 2.0 ( access )

PST label: HR8910C-6xHis-61-126
Current location: UGA
PST buffer: NMR buffer 6.5-200mM NaCl - 1 x Proteinase Inhibitors 0.02 % NaN3 10 mM DTT 5 mM CaCL2 200 mM NaCL 20 mM MES pH 6.5 10 % D2O 50 uM DSS
PST volume: 0.5 mL
PST protein concentration: 0.30 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
HR8910C-NHT.1-NCc-25694F1.ab1
HR8910C-NHT.1-NCc-T7F1.ab1
HR8910C-NHT.1-NC5a-25694F1.ab1
HR8910C-NHT.1-NC5a-25666F1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2012-07-11 )

Sequence   (purification tags are colored blue)
MDVEAWLDERVPLVETHHHHHHENLYFQSHMAMKPPGAQGSQSTYTDLLSV
IEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART


Sequence stats ( 97 residues )
Met: 5 Gly: 5 Cys: 1 Pro: 4 Asn: 2
Ile: 4 Leu: 8 Val: 5 Trp: 1 Gln: 3

Sample precipitation:
Unkown

Recommended authors:
No authors listed

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)