JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

hr8998c.009
target record [HR8998C]
construct record [HR8998C-610-739-15.6
expression record [HR8998C-610-739-15.6-NC5e]   [HR8998C-610-739-15.6-NC5d]  
purification record [HR8998C-610-739-15.6-[NC5d,NC5e]-GF]

Proteus 2.0 ( access )

PST label: no lablel
Current location: Buffalo
PST buffer: NMR Buffer 6.5 - 0.02 % NaN3 10 mM DTT 5 mM CaCL2 100 mM NaCL 1 x Proteinase Inhibitors 20 mM MES pH 6.5 10 % D2O 50 uM DSS
PST volume: 0.5 mL
PST protein concentration: 0.37 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
HR8998C-610-739-15.6-NC5a-T7_22Jan13LMF1.ab1
HR8998C-610-739-15.6-NC5a-T7_Terminator_12DEC12JSR1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   Buffalo ( 2013-08-28 )

Sequence   (purification tags are colored blue)
MGHHHHHHSHMQELPDSGALMLVPNRQLTADYFEKTWLSLKVAHQQVLPWR
GEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELLLE
PGNSEMQISVKQNEARTETLNSFISVLETVIGTIEEIKS


Sequence stats ( 141 residues )
Met: 6 Gly: 7 Cys: 1 Pro: 6 Asn: 5
Ile: 7 Leu: 17 Val: 8 Trp: 3 Gln: 10

Sample precipitation:
Unkown

Recommended authors:
Haleema Janjua, Rong Xiao

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)