JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

hr9129a.007 parent PST record: HR9129A.004
target record [HR9129A]
construct record [HR9129A-728-786-15.2]
expression record [HR9129A-728-786-15.2-NC5a]
purification record [HR9129A-728-786-15.2-NC5a-GF]

Proteus 2.0 ( access )

PST label: no lablel
Current location: Buffalo
PST buffer: NMR 6.5 100mM NaCl -
PST volume: 0.5 mL
PST protein concentration: 0.63 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

(Ship this sample)
Last shipment sent to:   Buffalo ( 2013-10-08 )

Sequence   (purification tags are colored blue)
MGHHHHHHSHMIRSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWL
EGTLNGKRGLIPQNYVKLL


Sequence stats ( 70 residues )
Met: 2 Gly: 6 Cys: 1 Pro: 3 Asn: 2
Ile: 4 Leu: 6 Val: 3 Trp: 1 Gln: 2

Sample precipitation:
Unkown

Recommended authors:
Haleema Janjua, Rong Xiao

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)