JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

hr9134a.006 parent PST record: HR9134A.002
target record [HR9134A]
construct record [HR9134A-20-117-15.4]
expression record [HR9134A-20-117-15.4-NC5a]
purification record [HR9134A-20-117-15.4-NC5a-GF]
aggregation screening [screening record] (purification batch level data)

Proteus 2.0 ( access )

PST label: no lablel
Current location: UGA
PST buffer: Low Salt - 5 mM DTT 100 mM NaCl 10 mM Tris-HCl pH 7.5 0.02 % NaN3
PST volume: 1 mL
PST protein concentration: 1.05 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
HR9134A-20-117-15.4-NC5a-T7_26APR2013_TNF1.ab1
HR9134A-20-117-15.4-NC5a-T7Terminator_06MAY13JSR1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2013-06-06 )

Sequence   (purification tags are colored blue)
MGHHHHHHSHMSWYHRDLSRAAAEELLARAGRDGSFLVRDSESVAGAFALC
VLYQKHVHTYRILPDGEDFLAVQTSQGVPVRRFQTLGELIGLYAQPNQGLV
CALLLPV


Sequence stats ( 109 residues )
Met: 2 Gly: 9 Cys: 2 Pro: 4 Asn: 1
Ile: 2 Leu: 15 Val: 9 Trp: 1 Gln: 6

Sample precipitation:
Unkown

Recommended authors:
Haleema Janjua, Rong Xiao

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)