JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

nsr264.008
target record [NsR264]
construct record [NsR264-21.4]
expression record [NsR264-21.4-NC5a]
purification record [NsR264-21.4-NC5a-GF]
aggregation screening [screening record] (purification batch level data)

Proteus 2.0 ( access )

PST label: NsR264-1-102-6xHis
Current location: UGA
PST buffer: NMR buffer 4.5 - 1 X Proteinase Inhibitors 0.02 % NaN3 10 mM DTT 5 mM CaCL2 100 mM NaCL 20 mM NH4OAc pH 4.5 10 % D2O 50 uM DSS
PST volume: 0.5 mL
PST protein concentration: 0.57 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
NsR264-21.4-SeMa-21661F1.ab1
NsR264-21.4-SeMa-21077R1.ab1
NsR264-21.4-NCa-23805R1.ab1
NsR264-21.4-NCa-23691F1.ab1
NsR264-21.4-NCa-23691F2.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2011-03-09 )

Sequence   (purification tags are colored blue)
MTGQELRQLLLDKWGYSYDVQFRRTQGKIFLQVMWKYLEQASFPMNETEYQ
EHLDSVANYLHALGGAVQVKTFITQTKERPRLGKAVSIPLDLGERASEWII
LEHHHHHH


Sequence stats ( 110 residues )
Met: 3 Gly: 7 Cys: 0 Pro: 3 Asn: 2
Ile: 5 Leu: 13 Val: 6 Trp: 3 Gln: 9

Sample precipitation:
Unkown

Recommended authors:
Dan Lee, Colleen Ciccosanti, Haleema JanjuaJ. Liu, B. Rost, , T.B. Acton, R. Xiao, J.K. Everett, G.T. Montelione, Northeast Structural Genomics Consortium (NESG)

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)