JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

or109.008 parent PST record: OR109.007
target record [OR109]
construct record [OR109-29.1]
expression record [OR109-29.1-NC5a]
purification record [OR109-29.1-NC5a-GF]

Proteus 2.0 ( access )

PST label: OR109-1-78-6xHis
Current location: UGA
PST buffer: LOW SALT, PH 7.5 - 100 mM NaCl 5 mM DTT 0.02 % NaN3 10 mM Tris-HCl pH 7.5
PST volume: 1 mL
PST protein concentration: 1.05 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
OR109-29.1-SeM-R1-25694R1.ab1
OR109-29.1-SeM-R1-25666F1.ab1
OR109-29.1-SeM-R1-25666F1.ab1
OR109-29.1-SeM-R1-25694R1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2012-12-19 )

Sequence   (purification tags are colored blue)
MGEMDIRFRGDDLEALEKALKEMIRQARKFAGTVTYTLDGNDLEIRITGVP
EQVRKELAKEAERLAKEFNITVTYTIRLEHHHHHH


Sequence stats ( 86 residues )
Met: 3 Gly: 5 Cys: 0 Pro: 1 Asn: 2
Ile: 6 Leu: 8 Val: 4 Trp: 0 Gln: 2

Sample precipitation:
Unkown

Recommended authors:
No authors listed

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)