JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

or15.008
target record [OR15]
construct record [OR15-29.1]
expression record [OR15-29.1-NC5b]
purification record [OR15-29.1-NC5b-GF]

Proteus 2.0 ( access )

PST label: OR15-1-76-6xHis
Current location: UGA
PST buffer: NMR buffer 4.5-200mM NaCl - 1 X Proteinase Inhibitors 0.02 % NaN3 10 mM DTT 5 mM CaCL2 200 mM NaCL 20 mM NH4OAc pH 4.5 10 % D2O 50 uM DSS
PST volume: 0.5 mL
PST protein concentration: 0.87 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
OR15-29.1-21077R1.ab1
OR15-29.1-21131F1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2009-07-06 )

Sequence   (purification tags are colored blue)
MGHHHHHHSHMEMDIRFRGDDLEAFEKALKEMIRQARKFAGTVTYTLDGND
LEIRITGVPEQVRKELAKEAERLAKEFNITVTYTIR


Sequence stats ( 87 residues )
Met: 4 Gly: 5 Cys: 0 Pro: 1 Asn: 2
Ile: 6 Leu: 6 Val: 4 Trp: 0 Gln: 2

Sample precipitation:
Unkown

Recommended authors:
Jessica Y. Locke, Colleen Ciccosanti, Mei Jiang , T.B. Acton, R. Xiao, J.K. Everett, G.T. Montelione, Northeast Structural Genomics Consortium (NESG)

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)