JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

or258.005
target record [OR258]
construct record [OR258-29.1]
expression record [OR258-29.1-NC5a]
purification record [OR258-29.1-NC5a-GF]

Proteus 2.0 ( access )

PST label: OR258-1-126-6xHis
Current location: UGA
PST buffer: Low Salt - 5 mM DTT 100 mM NaCl 10 mM Tris-HCl pH 7.5 0.02 % NaN3
PST volume: 0.5 mL
PST protein concentration: 0.89 mM
PST tube format: NMR tube
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
OR258-29.1-NC5a-25666F1.ab1
OR258-29.1-NC5a-25694R1.ab1
OR258-29.1-NC5a-25666F1.ab1
OR258-29.1-NC5a-25694R1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2012-12-19 )

Sequence   (purification tags are colored blue)
MGTVVIVVSRDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQG
RPIVIFIRGATEEVVRDIVEYAQKEGLRVLVIMVDQDQEELERIYEQLKKD
GVDVRVTDNEDEAKKRLKELLEKVLEHHHHHH


Sequence stats ( 134 residues )
Met: 2 Gly: 5 Cys: 0 Pro: 2 Asn: 2
Ile: 9 Leu: 12 Val: 20 Trp: 0 Gln: 5

Sample precipitation:
Unkown

Recommended authors:
No authors listed

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)