JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

or33.009
target record [OR33]
construct record [OR33-29.1]
expression record [OR33-29.1-NC5a]
purification record [OR33-29.1-NC5a-GF]

Proteus 2.0 ( access )

PST label: OR33-1-112-6xHis
Current location: UGA
PST buffer: NMR buffer 6.5 - 0.02 % NaN3 10 mM DTT 5 mM CaCL2 100 mM NaCL 1 x Proteinase Inhibitors 20 mM MES pH 6.5 10 % D2O 50 uM DSS
PST volume: 1 mL
PST protein concentration: 0.92 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
OR33-29.1-23805R1.ab1
OR33-29.1-23691F2.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2011-04-13 )

Sequence   (purification tags are colored blue)
MSGKKVEVQVKITCNGKTYERTYQLYAVRDEELKEKLKKVLNERMDPIKKL
GCKRVRISIRVKHSDAAEEKKEAKKFAAILNKVFAELGYNDSNVTWDGDTV
TVEGQLEGVDLEHHHHHH


Sequence stats ( 120 residues )
Met: 2 Gly: 7 Cys: 2 Pro: 1 Asn: 5
Ile: 5 Leu: 9 Val: 12 Trp: 1 Gln: 3

Sample precipitation:
Unkown

Recommended authors:
Sai Tong, Colleen Ciccosanti, Haleema Janjua , T.B. Acton, R. Xiao, J.K. Everett, G.T. Montelione, Northeast Structural Genomics Consortium (NESG)

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)