JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

or358.009 parent PST record: OR358.005
target record [OR358]
construct record [OR358-21.1]
expression record [OR358-21.1-NC5a]
purification record [OR358-21.1-NC5a-GF]

Proteus 2.0 ( access )

PST label: no lablel
Current location: UGA
PST buffer: Low Salt - 5 mM DTT 100 mM NaCl 10 mM Tris-HCl pH 7.5 0.02 % NaN3
PST volume: 1 mL
PST protein concentration: 1.15 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

Available construct sequencing results:
OR358-21.1-NC5a-T7_Terminator_12DEC12JSR1.ab1
OR358-21.1-NC5a-T7_22Jan13LMF1.ab1
OR358-21.1-NCa-T7_Terminator_12DEC12JSR1.ab1
OR358-21.1-NCa-T7_22Jan13LMF1.ab1

Recommended DNA sequencing chromatogram viewer:
FinchTV ( download )

(Ship this sample)
Last shipment sent to:   UGA ( 2013-12-18 )

Sequence   (purification tags are colored blue)
MVDLKIDVSDDEEAEKIIREIREQWPKATVTRTNGDIKLDAQTEKEAEKME
KAVKKVKPNATIRKTGGSLEHHHHHH


Sequence stats ( 77 residues )
Met: 2 Gly: 3 Cys: 0 Pro: 2 Asn: 2
Ile: 6 Leu: 3 Val: 5 Trp: 1 Gln: 2

Sample precipitation:
Unkown

Recommended authors:
Keith Hamilton, Rong Xiao

No structure records are associated with this pst.

Create new structure record:   (HSQC)   (NMR)   (Xray)