JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

or446.010
target record [OR446]
construct record [OR446-21.1]
expression record [OR446-21.1-NC5b]
purification record [OR446-21.1-NC5b-GF]

Proteus 2.0 ( access )

PST label: no lablel
Current location: UGA
PST buffer: PBS - 137 mM NaCl 2.7 mM KCl 10 mM Na2HPO4 1.8 mM KH2PO4 pH 7.4
PST volume: 0.5 mL
PST protein concentration: 1.00 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

(Ship this sample)
Last shipment sent to:   UGA ( 2014-09-11 )

Sequence   (purification tags are colored blue)
MGRLVVVVTSEQLKEEVRKKFPQVEVRLVTTEEDAKQVIKEIQKKGVQKVV
LVGVSEKLLQKIKQEANVQVYRVTSNDELEQVVKDVKGSGLEHHHHHH


Sequence stats ( 99 residues )
Met: 0 Gly: 5 Cys: 0 Pro: 1 Asn: 2
Ile: 3 Leu: 8 Val: 20 Trp: 0 Gln: 9

Sample precipitation:
Unkown

Recommended authors:
Haleema Janjua, Rong Xiao

Experimental records:   (HSQC)  

Create new structure record:   (HSQC)   (NMR)   (Xray)