JavaScript Menu Courtesy of Milonic.com

Protein Sample Tubes

display PST record Edit PST record Upload data as tsv PST Modifications Check Empty PST Record

or462.007
target record [OR462]
construct record [OR462-21.1]
expression record [OR462-21.1-NC5a]
purification record [OR462-21.1-NC5a-GF]

Proteus 2.0 ( access )

PST label: no lablel
Current location: Buffalo
PST buffer: Low Salt - 5 mM DTT 100 mM NaCl 10 mM Tris-HCl pH 7.5 0.02 % NaN3
PST volume: 0.5 mL
PST protein concentration: 1.00 mM
PST tube format: 1.7mL Eppendorf
PST Biotinylated: No

No comments associated with this pst id.

(Ship this sample)
Last shipment sent to:   Buffalo ( 2014-03-07 )

Sequence   (purification tags are colored blue)
MGVVILVLTGDERIAEELRKEVQKHDPNVKTVPTKDKEKVKEEIEKARKQG
RPIVVFVRGGDDERAKDIAEYAQKEGLRVIVIIVSQDEEALRKGYEDKKKK
GYDVYTSRNEDEAKKKLKEALEKSGSLEHHHHHH


Sequence stats ( 136 residues )
Met: 1 Gly: 9 Cys: 0 Pro: 3 Asn: 2
Ile: 8 Leu: 8 Val: 14 Trp: 0 Gln: 4

Sample precipitation:
Unkown

Recommended authors:
Haleema Janjua, Rong Xiao

Experimental records:   (HSQC)  

Create new structure record:   (HSQC)   (NMR)   (Xray)